PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim06g008200.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 477aa    MW: 51755.4 Da    PI: 4.7409
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim06g008200.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.14.7e-34263317155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r+rWtpeLHe+Fveav++LGGse+AtPk +l+lmkv+gLt++hvkSHLQkYR+
  Sopim06g008200.0.1 263 KQRMRWTPELHEAFVEAVNKLGGSERATPKGVLKLMKVEGLTIYHVKSHLQKYRT 317
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.436260320IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-31261319IPR009057Homeodomain-like
SuperFamilySSF466895.73E-18261317IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-25263317IPR006447Myb domain, plants
PfamPF002492.9E-10265316IPR001005SANT/Myb domain
PfamPF143794.1E-24348395IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MEARPALSVQ RTGAHQLSNF GASGAHSSLP VLQTSLEEKY PKLPGSALSS FPSNSGAVGH  60
LFSSPSEFST NLDFSSVLPY DEHLAPATFI SQPTINEASI PLANSGVLQG AASSQYVNVN  120
SESWCTELLP DYLDYSVNAP VQNTQLDCRN SDDCQIPPED PSKQSDWPEW ADLVMSDDDA  180
LTSSWMVDTS IADAEPKMQY QEQNQLSNFP VHQVQPFQQI PTASVETSAV VPASVETSAV  240
VPASVETSAV VPASSTGSGS SSKQRMRWTP ELHEAFVEAV NKLGGSERAT PKGVLKLMKV  300
EGLTIYHVKS HLQKYRTARY KPEASEGSSE KKESSIGDLS ALDLKTGIEI TEALRLQMEV  360
QKQLHEQLEI QRNLQLRIEE QGRCLQMMFE KQCKSMPGID LAKGSSSMAE DASAQLNDAV  420
QSSSNKNDPG ASLVGHHEAG SHTTQQLVRE KQKEHEREDI TSSSNSPPTK RAKVDE*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755180.0HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004240480.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
TrEMBLK4C3K00.0K4C3K0_SOLLC; Uncharacterized protein
STRINGSolyc06g008200.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27532349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.12e-78phosphate starvation response 1